PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID ONIVA08G24550.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family SBP
Protein Properties Length: 451aa    MW: 46189.4 Da    PI: 7.3168
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
ONIVA08G24550.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP112.82e-35117190278
                      -SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS
              SBP   2 CqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 
                      C v+gC++dls++++yhrrhkvCe+hsk+p v+vsg+e rfCqq   fh l+efDe+krsCr+rL++hn+rrrk+q+
  ONIVA08G24550.1 117 CAVDGCKEDLSKCRDYHRRHKVCEAHSKTPLVVVSGREMRFCQQ---FHLLQEFDEAKRSCRKRLDGHNRRRRKPQP 190
                      *******************************************9...***************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.102.3E-29110175IPR004333Transcription factor, SBP-box
PROSITE profilePS5114128.017114188IPR004333Transcription factor, SBP-box
SuperFamilySSF1036121.7E-33115193IPR004333Transcription factor, SBP-box
PfamPF031101.8E-25117187IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0048653Biological Processanther development
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 451 aa     Download sequence    Send to blast
MEWDLKMPPA ASWELADELE NSGGGGVPAA VSSSSAAVGG GVNAGGGGRQ ECSVDLKLGG  60
LGEFGGGGAQ PRVAVAGELA KGKGPAAAAT GAAAAASSAP AKRPRGAAAG QQQCPSCAVD  120
GCKEDLSKCR DYHRRHKVCE AHSKTPLVVV SGREMRFCQQ FHLLQEFDEA KRSCRKRLDG  180
HNRRRRKPQP DPMNSASYLA SQQGARFSPF ATPRPEASWT GMIKTEESPY YTHHQIPLGI  240
SSRQQHFVGS TSDGGRRFPF LQEGEISFGT GAGAGGVPMD QAAAAAAASV CQPLLKTVAP  300
PPPPHGGGGS GGGKMFSDGG LTQVLDSDCA LSLLSAPANS TAIDVGGGRV VVQPTEHIPI  360
AQPLISGLQF GGGGGSSAWF AARPHHQAAT GATATAVVVS TAGFSCPVVE SEQLNTVLSS  420
NDNEMNYNGM FHVGGEGSSD GTSSSLPFSW Q
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A1e-231171871184squamosa promoter binding protein-like 4
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1170187KRSCRKRLDGHNRRRRKP
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00555DAPTransfer from AT5G50570Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1094690.0AK109469.1 Oryza sativa Japonica Group cDNA clone:001-128-D02, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015649377.10.0PREDICTED: squamosa promoter-binding-like protein 16
SwissprotQ6YZE80.0SPL16_ORYSJ; Squamosa promoter-binding-like protein 16
TrEMBLA0A0E0IF010.0A0A0E0IF01_ORYNI; Uncharacterized protein
STRINGLOC_Os08g41940.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP17553795
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G50670.14e-38SBP family protein